SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014169 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014169
Domain Number 1 Region: 110-444
Classification Level Classification E-value
Superfamily ARM repeat 1.87e-27
Family Plakophilin 1 helical region 0.085
Further Details:      
 
Domain Number 2 Region: 553-682
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000000942
Family Toll/Interleukin receptor TIR domain 0.0064
Further Details:      
 
Domain Number 3 Region: 477-539
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000886
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014169   Gene: ENSAPLG00000014332   Transcript: ENSAPLT00000014943
Sequence length 715
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743696.1:759757:765907:1 gene:ENSAPLG00000014332 transcript:ENSAPLT00000014943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTLLVSVYKLCRFFAMSGMERLEVPECVSQAGCWAAGSSGEHREVSPGVNTDVRAALE
RILPALQRSIACAKQAAGPGELRQAIGEVFQLVEEAWGMPTLGRDVAKVLCDVIRLEGGL
DLLLNLLYTAELETKCQAGKLLEQILVAENRDRIARIGLGVILNLAKERDIPPLAQSVSG
ILEHMFKHTEETCSQLISDGGLDAILYWCRWTDPVVLRHCAMALANCAMHGGQANQRLMI
EKRTAEWLFPLVFSRDDELIRLHACLAITVLATNKEIEKEVERSGTLALVEPFIASLDPE
RFACRMLGSSDSSQGRTAEDLQRLVPLLDSSRLEAQCIAAFYLCAEAAIKTRQKQTKIFS
EIGATQSLKRVVCYSTSSTTSSLAKKVLRMIGEEVPRRILPTVPNWKPCEVQTWLQQIGF
NKYCQSFLDHQVDGDILLRLTEEELQEDLGMGSSITRKRFFRELTELKTFANYSTCDRSN
LADWLGGIDPRFRQYTYNLLTCGINRSFLHRVTEQQLQDDCHIATGFHRVRILSAAREML
HSPITLQTASDGTDVFISYRRSTGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQ
SVLSARNFVLVLSPNALDKCMADPECKDWVHKEIVTALNSGKNIVPVTDHFEWPDPETLP
KDMRAVLKFNGIKWSHEYQEATIDKIIRFLQGRSSRDSSAGSENGLDCLPAPGQT
Download sequence
Identical sequences U3J3U2
XP_012960058.1.99704 ENSAPLP00000014169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]