SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014273 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014273
Domain Number 1 Region: 480-532
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000803
Family UBA domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000576
Family Ubiquitin-related 0.00029
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014273
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily ARM repeat 0.000184
Family Mo25 protein 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014273   Gene: ENSAPLG00000014441   Transcript: ENSAPLT00000015048
Sequence length 536
Comment pep:novel scaffold:BGI_duck_1.0:KB742573.1:510282:522588:-1 gene:ENSAPLG00000014441 transcript:ENSAPLT00000015048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLTQHGIHDGLTVHLVIKTQNRSQDHTAQQT
NTAGSTATTSTSSSSTSTTASTNSNPFGLGKNGGLGGLAGLSTLGLNTSNFSELQSQMQR
QLMSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQ
TLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFA
SLVSNASSGGDSQPSRTENRDPLPNPWAPQSSSQSSTTNTSNSGESGGSSTVGNSNSGST
GQSSTIPNLGPGLGAGMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLA
VQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNSRAMQALLQIQQGLQTLA
TEAPGLIPGFNPGLGGLGSTGTPTGSTVSSSVPSENTSPASGSTEPSHQQFVQQMLQALA
GANAQQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences U3J446
ENSAPLP00000014273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]