SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014283 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014283
Domain Number 1 Region: 196-341
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 2.2e-60
Family DP dimerization segment 0.000000116
Further Details:      
 
Domain Number 2 Region: 110-190
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-23
Family Cell cycle transcription factor e2f-dp 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014283   Gene: ENSAPLG00000014438   Transcript: ENSAPLT00000015058
Sequence length 407
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743304.1:353267:380140:-1 gene:ENSAPLG00000014438 transcript:ENSAPLT00000015058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGLIEANGELKVFIDQNLSPGKGVVSLLAVHPSTVNTLGKQLLPKTFGQSNVNITQQVVI
STPQRPSAPNTILVGSPHTPNTHFVSQNQTADSSPWSAGKRNKKGEKNGKGLRHFSMKVC
EKVQRKGTTSYNEVADELVAEFSTTDNHISPNESAYDQKNIRRRVYDALNVLMAMNIISK
EKKEIKWIGLPTNSAQECQNLEVEKQRRLERIKQKQSQLQELILQQIAFKNLVQRNRQAE
QQANRPPPSNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVLKRMG
MACGLESGSCSAEDLKIARSLVPKALEPYVTEMAQGSISSVYVTSSSGSASNGTRFSASD
FSNGGDGMLATSSNGSQYSGSRVETPVSYVGDDDDDDDDFNENDDDD
Download sequence
Identical sequences U3J456
ENSAPLP00000014283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]