SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014289 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014289
Domain Number 1 Region: 168-316
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-38
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-36
Family Second domain of FERM 0.0000764
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.57e-19
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014289   Gene: ENSAPLG00000014391   Transcript: ENSAPLT00000015065
Sequence length 677
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742929.1:2049377:2089092:1 gene:ENSAPLG00000014391 transcript:ENSAPLT00000015065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKAKGQLLFEQIMYHLDLIESDYFGLRFMDSAQVAHWLDNTKSIKKQVKIGPPYCLHFRV
KFYSSEPNNLREELTRYLFVLQLKLDILSGKLECPFDTAVQLAAYNMQAELGDYDPAEHV
PELVSEFRFVPTQTEEMELAIFEKWKECRGQTPAQAETNYLNKAKWLEMYGVDMHIVKAR
DGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDEQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSSRSGFIRLGSRFRYSLSGKTEYQTTKT
NKARRSASFERRPSKRYSRRTLQSKAHVAKLEETSFPNNAVITQTNGSQQSWNAKPNVPV
LTAAVPSAPVLVEIENLPRSPGASQQDKKCVPLVDLLDSTDLPETCVDDAVGHPIVGLAT
RESEEFVSCPHPGTKETSNSFSAFEDALLKLKQLEAECSSPVPAERPNININLQVQDEVV
KLTDKCLNNAIESPVAAAAWLPADMKSNILKAQAEAGHKAVREDNLAGTKSSIIQDAAAS
NTSNEDSAASSHEELLIPASLAPEEEAAVSKSTPDDQDVSLTSLTENLIDFTEATPRVSP
QPTITPRWIVPPIQTGLISNGPLGNDVALALKAMEGSTEALLPSAGLPPSQQTSEVLASP
VTEDSTIRTKCLLTTEL
Download sequence
Identical sequences U3J462
ENSAPLP00000014289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]