SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014340 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014340
Domain Number 1 Region: 113-181
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-17
Family Cell cycle transcription factor e2f-dp 0.0056
Further Details:      
 
Domain Number 2 Region: 250-334
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000132
Family Cell cycle transcription factor e2f-dp 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014340   Gene: ENSAPLG00000014506   Transcript: ENSAPLT00000015116
Sequence length 903
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742497.1:265503:279273:-1 gene:ENSAPLG00000014506 transcript:ENSAPLT00000015116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENIFDRSRMAPKTPIKNEPVDLSKQKGCTPERNPITPVKLIDRPQPDPWTPTANLKMLVS
AASPDMRDREKKKELFRPIENSEQNDISDSLQYDMVDDSTVDEFEKQRPSRKQKSLGLLC
QKFLARYPSYPLSTEKTTISLDEVASILGVERRRIYDIVNVLESLHLVSRVAKNQYCWHG
RHNLSQTLKTLQEAGELQYGELLTFQHKEQDFEYKLGERKKETVPDSQDRPLLDFSEPDC
TSASANSRKDKSLRIMSQKFVMLFLVSKTKIVTLDIAAKILIEETQDTVDHSKFKTKVRR
LYDIANVLTSLCLIKKVHVTEERGRKPAFKWIGPVEFPGKIDEPRGHNGTSDPLPGEQRG
ACAPYQICATGKQRFTRHASFNGMQPCEGTKRKVSSEPSSPRQERQACIVNSDEYCSKMI
NLATVCRQKIDEDTRTKVCATETVLNSARNPSIASPLSLLTVPGDSDFCVNPLPQAVFPV
VQADVPGVLLPNGVSNQTLQPSAAAASKTENGKPTLLPSQPFLCFPSSSLFMLCGGLQEN
LLRENLPAAGDIGNRSTEEKASPMEAQGAGPPAGCQKRSSHECMSPSAPVDDEEPAAKKQ
TMEQGDGPLSLVVPKKPSELHKADSTPGSSCASAVHLEAFHLDPSSPAAPETEDKKSMSP
LHSQEQEKRPKNKDPDEPSPGKEHPSKENANQPFLPQYLYVQPTAGLSNFNFLFSPNQAP
GAIGLAAGQLPSLSIPCVMVPSAALASFPLVCSPAIPSPLSPVPDGSFSAAAPMNISMSG
LASTAPVLIGTTAMVTPNAPPSVDPQQAAHPAVHLSPVLARSCSTVKLDSPVCMGHPVTL
LKLQQPSSTPVTPKSIRPARHETFFKTPGSLGDPGAWKKGEGSQTRNASSVQRRLEISSS
SND
Download sequence
Identical sequences U3J4B3
ENSAPLP00000014340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]