SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014374 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014374
Domain Number 1 Region: 239-360
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.61e-41
Family ets domain 0.00058
Further Details:      
 
Domain Number 2 Region: 12-81
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.4e-27
Family Pointed domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014374   Gene: ENSAPLG00000014526   Transcript: ENSAPLT00000015150
Sequence length 375
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743553.1:187437:191958:1 gene:ENSAPLG00000014526 transcript:ENSAPLT00000015150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEGEIFRLPGRLRIQPSLWSKDDVIHWLRWAEKEYSLRQTEESKFEMNGKALCILTKDDF
RYRAPSSGDVLYELLQYIKTQRRALVCSPLLNSPFQEARTTEEGMMENGGYEAMPSLSYQ
ERFGCHVSTHLGFEAQPAEPISQYLSKESRTYMMIAASSNKIQVIKKIHSEQVRVWFGGV
SSRVGSVSKRAICLCSSIFLYFSFSFPLSLGHTELSSSRSWEEPLNLSHHNPEGSCRADS
VCSFPTALSAPVDGKIADCRLLWDYVYQLLSDSRYMPYIRWEDKEAKVFRIVNPNGLAQL
WGNHKNRMNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGEIVHEKSSKLEQLEN
EDHEDLKEDPLEVSS
Download sequence
Identical sequences U3J4E7
ENSAPLP00000014374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]