SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014382 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014382
Domain Number 1 Region: 241-435
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.71e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000401
Further Details:      
 
Domain Number 2 Region: 68-208
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.05e-23
Family CRAL/TRIO domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014382   Gene: ENSAPLG00000014489   Transcript: ENSAPLT00000015158
Sequence length 440
Comment pep:novel scaffold:BGI_duck_1.0:KB742689.1:294102:313442:1 gene:ENSAPLG00000014489 transcript:ENSAPLT00000015158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTMATDPLSELQDDLNLDDTNQSLSQLKLASIDDKNWPADEVPAFPKSEDSKGSPEPVT
HLRWDDPYYDIARHHIVEVAGDDKYGRKVILFSACRMPPSHQLDHVKLLGYLKFTLDQYV
ESDYTLVYLHHGLTSENKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKP
LISFKFGRKIFYVNFLSELEEYVKLEQLGIPSQVLKYDEYLRSLQKPAQVPQKPTPPRPP
LPNQQFGVSLQHLREKSPDQSPVPLVVRETIAHLQEHALATEGIFRRSANTQVVREVQQK
YNMGVPVDFQQYEDVHLPAVILKTFLRELPEPLLTFGLYSHVVSFQSVEEENRVDVVRKT
LQSLPEENYEVLHLLTAFLVQVSAHSDRNKMTNTNLAVVFGPNLLWAKDVAITLKAINPI
NTFTKFLLDHQKELFENVEA
Download sequence
Identical sequences R0K6N9
ENSAPLP00000014382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]