SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014455 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014455
Domain Number 1 Region: 284-379
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.49e-32
Family Forkhead DNA-binding domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014455   Gene: ENSAPLG00000014618   Transcript: ENSAPLT00000015232
Sequence length 569
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743696.1:824128:842601:1 gene:ENSAPLG00000014618 transcript:ENSAPLT00000015232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLLQDQSNIKFSASDTLERDQQEDFMKTQGDSISPVQQTDNPSYNCQAYESDGRTERK
SSESSHSPSPASPVQDQIHGRYPTSQGIHCGKNKFKVSFSAEKFRRYSYEESTVGNYDRF
LKSSRNPFHPYKRQISEDVFQEAHQALPPEGPPFKNARSIDCFEGLPGSTGPDESESFPT
HIPNISSEQPWCNSLQYSTPGQDHSSQVMQDSDIKLRTSPLEGQPGLYCYQPQVQQMYCP
SHPFHQHQYPSGGSYPVTYITSSHYPYQRIAPQSSQESQQPLFPKPIYSYSILIFMALKN
SKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKTGNSSRKGCLW
ALNPAKIDKMQEELQKWKRKDPVAVRKSMAKPEELDTLIGDKSEKLRSSIMSCSPTAVGS
ASLSRQMAVQPHSLGEPSLSSGVPPPLHPIHTPGALHVKNPVPSLLGGQQTACYTSPPGF
PPMSSTLMQQTPEHQPLFPSGEAPNEARSQPGISQDSPLPAQTPPACGMKVLAEQSAART
VHDPLLQEGDLSTDIDALNPSLTDFDLQG
Download sequence
Identical sequences U3J4M8
ENSAPLP00000014455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]