SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014464 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014464
Domain Number 1 Region: 514-616
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.0000339
Further Details:      
 
Domain Number 2 Region: 1003-1073
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.29e-18
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014464
Domain Number - Region: 695-860
Classification Level Classification E-value
Superfamily Tropomyosin 0.00222
Family Tropomyosin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014464   Gene: ENSAPLG00000014577   Transcript: ENSAPLT00000015241
Sequence length 1118
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742513.1:1418337:1559857:1 gene:ENSAPLG00000014577 transcript:ENSAPLT00000015241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTESSGERSTLRSASPHRNAYRTEFQALKSTFDKPKSDGDQKTKEEGEASQSRGRKYG
SNVNRIKNLFMQMGMEPTESAGVAPKTRGKGGPPSPQRRIRPKEFVEKTDGSIVKLESSV
SERISRFDTIHDGPSYSKFTETRKMFERNAHETGPSNRYSPKKEKAASTELADEWCSSKS
HRGSTDSLDSLSPRTETVSPTVSQLSAVFENADAHNVIVLEKAENNEEYSVTGHYPLNLS
STVANISSPVANLEGFSPLKDASTWSPPAKAAAGPMSVEHSQQNSAPSAPRQKVSTGTPS
GSKTTEEIKKNAEASADPGESSVGSQQESVLDSERCVDSSARSKSKTDAEIALRPKELSE
HAEGIADRPEAAETPRNLVSDLAADAVSDATETHYDDASEKEVHEDVNNFQSSHVYMHSD
YNVYRVRSRYNSDWGETGTEQDDQDDSDENNCYEPDMEYSEINGLPDEDEIPANRKIQFS
RAPIKVFNTYSNEDYDRRNDEVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIG
MGVGADAGLEKLGIFVKTVTEGGAAERDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNT
KGKVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLEQHYAQYDADDDETGEYATDEED
EDMGPVLPGGDMAIEVFDLPENDDMFSPSDVDTSKLAHKFKELQIKHAVTEAEIQKLKTK
LQAAENEKVRWELEKTQLQQNIEENKERMMKLESYWIEAQTLCHTVNEHLKETQSQYQAL
EKKYNKAKKLIKDFQQKELDFIKRQEAERKKIEDLEKAHLAEVQGLQARIRDLEAEVFRL
LKQNGSQVNNNNNIFERQTSFGEVSRGDPVENLDTKQVSCLDGLSQDFNEAVPETERLDS
KALKTRAQLSVKNKRQRPTRTRLYDSISSTDGEDSLERKNFAFNDDFSPSSTSSADLSGL
GAEPKTPGFSHSLALSSDESLDMIDDEILDDGQSPKHSQCQNRAVQEWSVQQVSHWLMSL
NLEQYVSEFSAQNINGEHLLQLDGSKLKALGMTSSQDRAIIKKKLKEMKASLEKARKAQE
KMEKQREKLRKKEQEQLQRKSKKTDKCSSDATEGTNEQ
Download sequence
Identical sequences U3J4N7
ENSAPLP00000014464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]