SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014508 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014508
Domain Number 1 Region: 243-427
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.32e-63
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.0023
Further Details:      
 
Domain Number 2 Region: 20-125
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.17e-43
Family Interferon regulatory factor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014508   Gene: ENSAPLG00000014646   Transcript: ENSAPLT00000015286
Sequence length 446
Comment pep:novel scaffold:BGI_duck_1.0:KB743404.1:1243543:1255574:-1 gene:ENSAPLG00000014646 transcript:ENSAPLT00000015286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLEPGECGMNSVSCGNGKLRQWLIDQIDSGKYPGLVWENDEKSIFRIPWKHAGKQDYNR
EEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKV
YRIVPEGAKKGAKQISMEEQPLMMNHPFPITSPYTSLPSQVPNYMVPHERNWREFAPEQP
HPDIPYQCASVPFTARGHHWQAPGCENGCQVTGTFYACAPPESQTPGIPIEPSIRSGEAL
ALSDCRLHICLYYREILVKEVTTTSPEGCRISQGQSYEVSSLEQVIFPYPEDNGQRKNIE
KLLSHLERGVILWMAPDGLYAKRLCQSRIYWDGPLALCSDRPNKLERDQTCKLFDTQQFL
AELQAFAHHGRPLPRYQVALCFGEEFPDPQRQRKLITAHVEPMFARQLYYFAQQNSGHLL
RGYDLPELVTSPEDYHRSIRHSSIQE
Download sequence
Identical sequences R0JP41
XP_005022913.1.99704 ENSAPLP00000014508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]