SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014516 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014516
Domain Number 1 Region: 358-565
Classification Level Classification E-value
Superfamily PUA domain-like 1.84e-79
Family SRA domain-like 0.00000000366
Further Details:      
 
Domain Number 2 Region: 657-712
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000381
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 274-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000576
Family PHD domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014516
Domain Number - Region: 1-44
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0357
Family Ubiquitin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014516   Gene: ENSAPLG00000014609   Transcript: ENSAPLT00000015294
Sequence length 736
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744239.1:136580:145487:1 gene:ENSAPLG00000014609 transcript:ENSAPLT00000015294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQQMEDGHSLFDYSVGLNDIVQLLVRQSPAVLPAVSKEKDSELSDTDSGCGSGQSESDKS
SHNGEGAMELEGQPSTAAQPDWTDPGFGLYKINDLVDARDMNMGAWFEAQVVNVTRKKAA
NDSCADPDQQTTIPEEDVIYHVKYEDYPENGVVELSSNDVRARARTILKWHQLEVGQVVM
VNYNPDEPKERGFWYDAEILQKRETKMIKEINAKILLGDAGDSLNDCTITFVDEIYKIEE
PGSACPISASPLKRQNGPVCKACKDNPNKTCRICACYICGGKQDPDKQLMCDECDMAFHI
YCLNPPLSSIPDDEDWYCPECRNDASEVVLAGEKLKESKKKQKMASANSSSRRDWGKGMA
CVGRTKECTIVPSNHYGPIPGIPVGTMWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVL
AGGYEDDIDHGNSFTYTGSGGRDLSGNKRTAEQSCDQKLTNMNRALALNCSAPINDKNGA
EAKDWRAGKPVRVVRNVKGGKHSKYAPVEGNRYDGIYKVVKYWPETGKSGFLVWRYLLRR
DDDEPAPWTKEGKDRMKKLGLTMQYPEGYLEAVANKDKEKENNRDDEFDTPGKGKRKRKS
AGGGEEKVINSPTGTPKKTKVEPYKLTSQQKSLIKSDEANEKLWNEVLDALKDGPKFLNK
VEEAFLCICCQEVVFRPVTTVCQHNVCKDCLDRSFKADVYSCPACRYDLGKNYTMQVNET
LQTILTQLFPGYGNGR
Download sequence
Identical sequences U3J4T9
ENSAPLP00000014516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]