SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014531 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014531
Domain Number 1 Region: 289-417
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.46e-43
Family Regulator of G-protein signaling, RGS 0.0000243
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-27
Family DEP domain 0.011
Further Details:      
 
Domain Number 3 Region: 214-277
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 8.63e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014531   Gene: ENSAPLG00000014655   Transcript: ENSAPLT00000015310
Sequence length 420
Comment pep:novel scaffold:BGI_duck_1.0:KB743520.1:1806139:2035196:-1 gene:ENSAPLG00000014655 transcript:ENSAPLT00000015310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLTKNLSIEDPVEALHLGTLMAAHGYFFP
ISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESL
ARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVD
IKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPVPETKPPTEDELHQEIKHWQMQLDRHR
LKMSKVAESLLAYTEQYLEYDPFLVPPDPSNPWISDDTTFWELEASKEPGQQRVKRWGFG
MDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPARVQEIWQEFLAPGA
PSAINLDSKSYDKTTQNVKDPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK
Download sequence
Identical sequences R0JLY6
ENSGALP00000015243 9031.ENSGALP00000015243 ENSAPLP00000014531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]