SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014545 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014545
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-40
Family Forkhead DNA-binding domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014545   Gene: ENSAPLG00000014712   Transcript: ENSAPLT00000015324
Sequence length 303
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743183.1:586918:587873:1 gene:ENSAPLG00000014712 transcript:ENSAPLT00000015324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSL
NKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGTSAFKRGARLTSTGLTFMDRAGSL
YWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTSNGLSVDR
LVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSM
TSQSSTSMTARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNP
LIH
Download sequence
Identical sequences U3J4W8
ENSAPLP00000014545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]