SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014565 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014565
Domain Number 1 Region: 1026-1095
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000614
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 2 Region: 899-975
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000271
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 
Domain Number 3 Region: 1108-1181
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000829
Family SAM (sterile alpha motif) domain 0.071
Further Details:      
 
Domain Number 4 Region: 260-446
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000425
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014565   Gene: ENSAPLG00000014630   Transcript: ENSAPLT00000015344
Sequence length 1271
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742677.1:1593762:1619163:1 gene:ENSAPLG00000014630 transcript:ENSAPLT00000015344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCEVMPTISEGDPLGPPQGSEADADFEQLMVNMLDERDKLLDTLRETRETLSVTQSRLQ
EALRERDQLQRQLNSALPQDLTSLTLCCVLLGLRSAPREFATLTRELSACREQLLEREEE
ISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEH
HKALDEKVRERLRASLERVATLEEQLVDAHRQLIPVGVQVAALQQGTTREAPAGERDERE
PKEPAQKLPWKRLSNGSVHPDDEAGRVVELQELLEKQNFEVVQAKERISALAASVAELEE
DLGTARKDLIKSEEMSSKYQRDLREALAQKEDMEERITTLEKRYLAAQREATSIHDLNDK
LESEPNKESLHRQCEEKARHLQELLELAEQKLQQTMRKAETLPEVEAELAQRIAALSKAE
ERHGSIEEHLRQLESQLEEKNQELARVGESSRVLIWPQLPLAVTVGAWTQHRAPHVQLHL
KERMAALEEKVILGQKSWNTSTTSPEQRRLSDEIDKLRLEVDQLKTRSGTFVESVHTSFL
KDNSAESLSYRGRNNPPVEIEHQNNKKWPRVQLQLMHFCVPEHRHKPGGGEDWEQAQAGS
VLATGPHAFDSDPEISDVDEDDRETLFSSMDVLSPGGHSDAQTLAMMLQEQLDAINEEIR
MIQEEKESTELRAEELETRVTSGSMEGLNLTQLCKRASIPTSLTALSLASSSPPLSGRST
PKLTSRSAAQDLDRMGIMTLPSDLRKHRRKLLSPAARDESREDKTTIKCETSPPSSPRTL
RLEKLGHPALSQEDGKRLCCSSPSSIPSSLEEQASNPSSNSSQDSLHKGSKRKGIKSSIG
RLFGKKEKGRLIQLSREGATDTEVGIQDPLGLGKLGAQAEKDRRLRKKHELLEEARRKGL
PFAHWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLK
LRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMENMATSTKTKDTEEGSWAQSVPSLSQ
TLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRT
SLQYGIMCLKRLNYDRKELERRREETQHEIKDVLVWTNDQVIHWIQSIGLREYANNLVES
GVHGALLALDENFDHNSLALVLQIPTQNTQARQVLEREFNNLLALGTDRRLDDGDDKTFR
RTPSWRKRFRPRDVHSINMLSGSAETLPSGCRVPSLVPLPPPSAPAKKMPPEVGASGSPR
LETSTVRTYSC
Download sequence
Identical sequences U3J4Y8
ENSAPLP00000014565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]