SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014580 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014580
Domain Number 1 Region: 169-270
Classification Level Classification E-value
Superfamily Acid proteases 1.27e-22
Family Retroviral protease (retropepsin) 0.0015
Further Details:      
 
Domain Number 2 Region: 33-157
Classification Level Classification E-value
Superfamily dUTPase-like 1.15e-20
Family dUTPase-like 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014580
Domain Number - Region: 6-32
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00201
Family Retrovirus capsid protein C-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014580   Gene: ENSAPLG00000014742   Transcript: ENSAPLT00000015359
Sequence length 273
Comment pep:novel scaffold:BGI_duck_1.0:KB742483.1:175299:176614:1 gene:ENSAPLG00000014742 transcript:ENSAPLT00000015359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGMPSYMGIKQGREEPFGLFIDRTSTSCDESLFLRPATRGSLGLDLATAVDVTLLDSRP
TRIKTGLIGPVIVNKEPVGALLIGRSSATMNGLQILTGLIDKDYFGEIQIMVSAMFPPIH
VPKGTKIAQLIPLPHLAESLASESAKHRGLGAFGSTGKVALLTLGMRHRPRQKVTVCLKD
EKIQIEALLDTGADVSIISTKDWPSHWPTFESNATVSGVGGMTLARRSPVLQWTIGDKVV
QCSVSILSLPEGVQALVGRDILAQMGAILTTDH
Download sequence
Identical sequences U3J503
ENSAPLP00000014580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]