SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014584 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014584
Domain Number 1 Region: 1185-1524
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-87
Family p120GAP domain-like 0.0000000000246
Further Details:      
 
Domain Number 2 Region: 1558-1698
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000837
Family CRAL/TRIO domain 0.019
Further Details:      
 
Domain Number 3 Region: 1824-1861,1895-1959,2175-2397,2589-2652
Classification Level Classification E-value
Superfamily ARM repeat 0.000038
Family HEAT repeat 0.094
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014584
Domain Number - Region: 670-828,864-1031,1074-1169,1223-1285,1330-1345
Classification Level Classification E-value
Superfamily ARM repeat 0.000326
Family MIF4G domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014584   Gene: ENSAPLG00000014612   Transcript: ENSAPLT00000015363
Sequence length 2815
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743217.1:160687:241291:-1 gene:ENSAPLG00000014612 transcript:ENSAPLT00000015363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPIKAGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTNILKNVNNMRIFGETAEKNLY
LSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFIHTYREGNQHAAELRNSASG
VLFSLSCNNFNAVFSRISTRLQELTVCSEDNADVHDIELLQYISVDCSKLKRLLQETVFK
FKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQTPQTDMADCAEKLFDLVDGFAEST
KRKAAVWPLQIILLVLCPEIIQDIAKDVVEETKMNKKLFLDNLRKALAGHSGSRQLTESA
AIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNPSKPFSRGNQNADIDLMIDCL
VSCFRINPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITNSALDWWPKIDAVYCHSMELR
SMFSETLHKAIQGCGAHPAIRMTPSLTFKEKMTSLKFKEKPTDLETRSYKFLLLSLVKLI
HADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSSMPDIAQEAMEALLVLHQLDSIDL
WNPDAPIETFWEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQSDRS
SCHFLFLYDVSGGGTSQMSLDHEEMKSCTPGATLRRGKGNSSMESTAGCSGTPICRKAQT
KLEVALYMFLWSPDIEAVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASVS
NMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDTHAKWEQATKLILNYPKTKMEDGQVT
ESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQHRSNAGLATYSP
PMGPVNERKGSMISMVSTEGNAETPVSKFIDRLLTLMVCNHEKVGLQIRTNIKDLVGLEL
SPALYPMLFNKLKNTISKFFDSQGQVLLTETNTQFVEQTIAIMKNLLDNHTEGSSEHLGQ
ASIETMMLNLVRYVRVLGNLVHAIQIKTKLCQLVEVMMERRDDLSFCQEMKFRNKMVEYL
TDWVMGTSNQATDEDVKCLTRDLDQASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLK
YFTLFMNLLNDCSEVEDDSAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSI
GLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAM
ALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIM
TFCFKVYGATYLQKLLEPLLRTVITSSEWQHVSFEVDPTRLEPTESLEENQRSLLQMTEK
FFHAIINSSSEFPPQLRSVCHCLYQATCHSLLNKATVKEKKENKKSVVSQRFPQNSIGAV
GSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHMRPFN
DFVKSNFDAARRFFLDIASDCPASDTVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSN
RDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFK
ALKTLNIFYQAGTSKAGNPVFYYIARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDL
THAGPSNRFKTDFLSKWFVVFPGFAYENVSAVFIYNCNSWVREYTKYHERLLTGLKGSKR
LIFIDSPGKLAEHIEHDQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVT
SAERTRVLGQTVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIVRSII
HIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFN
LKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELKHLC
LEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITD
LLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCLSP
TPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTLLVATGPLSLRASTHGL
VINIIHSLCTCSQLHFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDR
SFSPGSYERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQKFAFQYNPSLQ
PRALVVFGCISKRVSHGQIKQIIRILSKKKGLESCLKGPDNYNSQVLIEATVIALTKLQP
LLNKDSPMHKALFWVAMAVLQLDEVNLYSAGTALLEQNLHTLDSLRVFNDKSPEEVFMEI
RRPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRHPSPTTVARTVRILHTLLALVNKH
RNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKSLLLTDVSMENVPMDTYPIHHSDT
SYRTLKENQPWSSPKGSDRHLAASYPTVGQISPRTRKSMSLDMGQPSQANTKKLLGTRKS
FDHLISDTKAPKRQDMESGITTPPKMRRVAENDYEMETQRISPQQHPHLRKVSVSESNVL
LDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVVHNLLDSK
INTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQI
PDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPAVQSQLSITANLNLSNSMTS
LATSQHSPGIDKENVELSPTAGHANSGRMRHGSASQVQKQRSAGSLKRHSIKKIV
Download sequence
Identical sequences U3J507
ENSAPLP00000014584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]