SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014637 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014637
Domain Number 1 Region: 119-231
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.39e-27
Family DEP domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-23
Family Pleckstrin-homology domain (PH domain) 0.00073
Further Details:      
 
Domain Number 3 Region: 238-301
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000334
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014637   Gene: ENSAPLG00000014782   Transcript: ENSAPLT00000015419
Sequence length 308
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742443.1:10110:18366:-1 gene:ENSAPLG00000014782 transcript:ENSAPLT00000015419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKEGFLVKRGHVVHNWKVRWFVLLQDKLLYYKFEGGKKESSPKGRILLDGCTITCPCLEY
ENRPLLIKLRTKTNTDYFLECCSREERDSWALDITGAIHAGHPVQVQELHRMKNSFKLLE
NISLHHIVDKMRDSSTGIKLTRNLEQGNRYKETFTGSALVDWLISNNFAVSRFEAVTLAS
MLMEENFTKPVGTRSIEAMRYSDLSEQFLDDSTALYMFAESSKKMLSSKEELQFNISELS
GMIVKQGFLVKQGHKRKNWKVRKFVLRAEPAFLHYYDPTKEENKPVGGFSLRGCLVSALE
DNGVPAGK
Download sequence
Identical sequences U3J560
ENSAPLP00000014637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]