SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014718 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014718
Domain Number 1 Region: 529-771
Classification Level Classification E-value
Superfamily VPS9 domain 1.05e-53
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 80-187
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000727
Family SH2 domain 0.0037
Further Details:      
 
Domain Number 3 Region: 788-864
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000114
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014718   Gene: ENSAPLG00000014865   Transcript: ENSAPLT00000015501
Sequence length 889
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742470.1:10777:45184:-1 gene:ENSAPLG00000014865 transcript:ENSAPLT00000015501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQALLFPLQGEVQIGYDFKLIDTIASEIGELKHEMVQTDLTVEDESADLQSLVKDMGNVS
PEKKDVKGCPRDSGYDSLSNKLSILDKLLHTHPVWLQLGLNDAEAMEILRAQPAGIFLVR
KSARLQKKVISLRLPSDCGSCLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCISRDVL
PFTLKLPHAIAAAKTEIELEEIAQLGLNFWSSPANSNPPDPSPPRRPVPLDSACKGSRQL
CLINGVHSIRTRTPSELECSQTNGALCFINPLFLKVHSQDVSGSLKRQSLRSQDLNGTER
PRSPPPRPPPPSINSILTSPQLSRTIKQASMPETVNHKKERDLDLLQNKPAPIPPPRLKK
QAVCVEVEGSPKTAAVIRPVCSSVPVPEAAGVPGETPPEPALAVSKKSVATSSESYTPRN
GGRQRLSDMSISTSSSDSLDFDRSMPLFGYEGDTNSSLEDFEGESDQESMAPPLKPKKKR
NSSFVLPKIVKSQLRKVSGVFSSFMTPEKRMIKKIAEMSQDKRTYFGCLVQDYISFLQEN
KECHVSSTDMLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQIADVVLEKAMHKCILKP
LKGHIEAMLKEFHTADGSWKQLKENLQLVRQRNPQELGVFVPTPDFVDVEKIKVKFMTMQ
KMYSPEKKVMLLLRVCKLIYTVMENNSGRLYGADDFLPVLTYVLAQCDMLELDTEIEYMM
ELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSEARDTLRQWHKRRTTNRTIP
SVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQLCAEKFKVDNPKEYSLFLFVDD
TWQQLTEDTYPQKIKAELHSRPQPQVFHFVYKRINSDPYGAIFQNNSAS
Download sequence
Identical sequences U3J5E1
ENSAPLP00000014718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]