SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014762 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014762
Domain Number 1 Region: 282-474,756-903
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-97
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000366
Further Details:      
 
Domain Number 2 Region: 15-105
Classification Level Classification E-value
Superfamily DUSP-like 3.01e-30
Family DUSP, domain in ubiquitin-specific proteases 0.0000105
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014762
Domain Number - Region: 133-204
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.013
Family Ubiquitin-related 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014762   Gene: ENSAPLG00000014796   Transcript: ENSAPLT00000015545
Sequence length 925
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743209.1:81515:124886:1 gene:ENSAPLG00000014796 transcript:ENSAPLT00000015545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPLWQLNSRLAFSWRYLVDISWFKQWKKFVGFDSWDMFGVGDPSLFPGPVDNSGLFSDA
ETQSLKEHLIDELDYVLVPTEAWNKLVAWYGCIDGQQPIVRKVVEYGLFVKHCKVEVYLL
ELKLCESSDPDNVISCHFSKADTVATIEKEMRKLFNIPAEKETRLWNRYMSNTFEQLSKP
DSTVQDAGLYHGQVVLIEVKNDDDTWPRQHLLAKSSTATSRNFTTSSKSSASSYSSVSAT
SVITNGDSSNSYGLNSSHLGRGGSGFVCNSYNCGDSASLSQPGLCGLSNLGNTCFMNSAL
QCLSNTPPLTDYFLEDKYEAEINQNNPLGMRGEIAEAYAELIKQIWSGRQSHVAPRMFKK
VKYISLSATLFIGSMFLIFHYKELLSECHAALHDDVMKASKVHYSRIKELRSRTSQVVAK
EAWENHRLRNDSIIVDIFHGLFKSTLVCPKCSKVSVTFDPFCYLTLPLPLRRDRLMEVTL
VYADPQRRPVQYRVVVPMMGAISDLCESLSKLSGVPAENMVVTDVYNHRFHKIFQMDEGL
NHIMPKDDIFVYEVCKPSEDGSEYVTLSVYFREKTMRQSSNTSGTVLFGQPLLISVPKHK
LTVDHLYVVVLEQISRYVKLPLAEEYSTPCSDKGTCNGSSGVAEGDIEEMDHQDGGQEGK
EKLSEIECHSDGCMQVESTRDLQPCKKQHFTFSLVNSYGTSEINSIVEGKILKLNAFSTL
AIDWDSDTRRLLFDEQEAQAFEKHSSLLQPQKKKAVVALRDCIELFTTMETLGEHDPWYC
PNCKKHQQATKKFDLWSLPKILVVHLKRFSYSRYWRDKLDTVVEFPIRGLNMSEFVCDPR
RGSYIYDLIAVSNHYGAMGVGHYTAYAKNKVNDKWYYFDDSSVSAASEDQIVTKAAYVLF
YQRRTSEEHLAPSPPQEECDGMDTN
Download sequence
Identical sequences U3J5I5
ENSAPLP00000014762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]