SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014781 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014781
Domain Number 1 Region: 733-795
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000733
Family Ubiquitin-related 0.026
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014781
Domain Number - Region: 520-568
Classification Level Classification E-value
Superfamily CdCA1 repeat-like 0.0759
Family CdCA1 repeat-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014781   Gene: ENSAPLG00000014936   Transcript: ENSAPLT00000015564
Sequence length 1197
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743076.1:247372:259602:-1 gene:ENSAPLG00000014936 transcript:ENSAPLT00000015564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSHPAPRGGEEGGADYNSHNPXGGGGGKKRERRIFSGTCPEPKCQARLSIECTECGRRH
EQRQPDPDVVLHNLLRSALLGAGPARRSAELVKVMGLSNYHCKLLAPILARYGMDKQTGK
AKLLREMNQGEVFDCSLLGDRAFLIEPEHVETVGYGKDRSGSLVYLHDTLEDIKKANNSQ
ECLIPVHVDGDGHCLVHAVSRALVGRELFWHALRENLKKHFEENLSHYKALFHDFIDAAE
WEDIINECDPLFVPPEGVPMGLRNIHIFGLANVLHRPIILLDSLSGMRSSGDYSATFLPG
LVPLEKCMGKDGMLNKPICIAWSSSGRNHYIPLVGIKGAALPKLPRKLLPKAWGVPQDLI
KKYIKLEEDGGCIIGGDRSLQDKYLMRLVAAMEEVFMSKHGIHPSLVADVHQYFYRRTGV
IGVQPEEVTAAAKKAVTDNRLHRCLICGALSEHHVPPEWLAPGGKLYNLAKSTHGQLRPD
KNYSFPLNSLVCSYNPAKDVLVPDYSLSSLTACNWCHGNLVRRVREDGSVSYLDGDRTNT
RSTGGKCGCGFKHYWEGKEYDNLPEAFPITLEWGGRVVRETVYWFQYESDTSLNSNVYDV
AMKLVTKHFPGEFGSEILVQKVVNTILHQTAKKNPDDYTPVNIDGAHAQRADEVQQGQEA
EAQLPTKIILTGQKTKTLHKEELNMSKTERTIQQNIADQASVMQKRKSEKLKQEHKGQPR
TASPGAGREGPSSAPATPTKAPYSPTSTKEKKIRITTNDGRQSMLTLKCTTTFLELQESI
AREFNIPPYLQCIRYGFPPKELLPPKEGMENEPVPLQHGDRIAIEILKGKEESSQPAAAH
SAHAVKHEDVAVTSKISSKELQEQVDKEMYSLCLLATLMGEDVWSYAKGLPQLFQQGGVF
YSIMKKTTGLADGKHCTFPHLPGKNFVYNAAEDRLELCVDAAGHFPIGPDVEDLVKEALS
QVRAEATSRSREASPSHGMLKLGSGGVVKKKSEQLHNITAFQGKGHSLGTASSSQQHDQR
ARETPLLRKPSTETDFSPAKIEPSAFTAASGNSELIRIAPGVVTMRDSRQLDPTLIEAQR
KKLQEMVSSIQASMDRHLRDQNTEQSASVDVSQRKVEAVSSTAKTGSFQAGLPESFPAPG
GTERLNAESTDGNMVNSVGATFPARSKAQKGSSVEELEEMDSQDAGITNVTEPMDHS
Download sequence
Identical sequences U3J5K4
ENSAPLP00000014781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]