SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014902 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014902
Domain Number 1 Region: 497-602
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-22
Family PDZ domain 0.0000868
Further Details:      
 
Domain Number 2 Region: 977-1051
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.86e-17
Family SAM (sterile alpha motif) domain 0.054
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014902
Domain Number - Region: 695-848
Classification Level Classification E-value
Superfamily Tropomyosin 0.000262
Family Tropomyosin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014902   Gene: ENSAPLG00000015004   Transcript: ENSAPLT00000015688
Sequence length 1079
Comment pep:novel scaffold:BGI_duck_1.0:KB743045.1:295007:333967:1 gene:ENSAPLG00000015004 transcript:ENSAPLT00000015688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTEGKGERTLRSASPHRNAYKSDFHAIKCSFDGQKLSASSNGGGNDPHSRGRAATYGN
RVHKIKSMFLQMGGSASTPSCESSPPAETKLISRTTAAEHGPSPGSPSFLIVQKNNLHNT
STSPNNSPVDSLSVPSTADKVIRSNDEADLDKVALAEKFSETRKLFERNIKQRSSVDRYS
PSKCEKNEDKRRHGSASDYSSVGDHFSFNTEVSPPAVLELESFLGDSDTEESKEISKNDS
LNQDHLRGPYGLDSSAAVEKCPEKTASTKVPVTVRDELSEDMSSVPGQEAKWRTETVFSW
VSPMEGTHVELAVQDETSGHEKESLEKDRVVHEDQLLKYQAQKEKRSDYPLEVVEEFAER
IETNQEEARDGMSGKDGPVTQGRGVVEQEGDPEEDEEQRENFSAFGIENAAFDDDRDAEP
ENQGPEGKEILEGEEEYMYDSEYEEFPGLSEEEDPDPDRKVKFSTAPIKVFSTYSNEDYD
RRNEEVDPVAASAEYELEKRVEKMEVFPVEIEKGDSGLGISIIGMGVGADQGLEKLGIFV
KTITDGGAAQRDGRIKVNDQIVEVDGISLVGVTQFFAATVLKNTKGTVSRFLIGREKPGT
QSEVARLISETLEQERCLYEQHYVHDDTEQVRYHTYDDDYDDDDDTYESHLHEKSVEVFD
LPENEDISLPLDMDSAQSLLKFKELQLKHAVTVAEVNQLKEKLKIVEAEKNEWKLNRTQL
QQNLEENKEKIKKLETYWLEAQSLCKTVNEHLKETQEQYDALEKKYNKAKKLLKDYQQKE
IEFMKKEEDHSRVLEERDQQYAEQLKIYQEKITELENKLKEDVCQNAGQHNEQSKIREEN
EKETESIEERPNSSEMLISADFDAFVGDTPRLDTSAHKAKAQLALKVKRQPPSRSKLKES
LGAGQQAANLQEGKNYVSRVVIDDTYHSKPSCELSGLVTEPNLSGRSHTLTFSSNEILQA
LDDEFTTTGKQNQWHNRPISEWTTQQVCHWLMGMNMEQYITEFTAMNIDGQQLMQLDSEK
LKPQKALGVSSQNDRSTIKKKIKDIKKAQEKLEKQKEKFQKKEREVRKTGRVVTTLESS
Download sequence
Identical sequences U3J5X5
ENSAPLP00000014902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]