SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014920 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014920
Domain Number 1 Region: 7-375
Classification Level Classification E-value
Superfamily Cullin repeat-like 1.86e-95
Family Cullin repeat 0.00000807
Further Details:      
 
Domain Number 2 Region: 392-665
Classification Level Classification E-value
Superfamily Cullin homology domain 6.93e-69
Family Cullin homology domain 0.0000077
Further Details:      
 
Domain Number 3 Region: 686-772
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.89e-20
Family SCF ubiquitin ligase complex WHB domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014920   Gene: ENSAPLG00000015028   Transcript: ENSAPLT00000015707
Sequence length 772
Comment pep:novel scaffold:BGI_duck_1.0:KB743885.1:343640:366284:-1 gene:ENSAPLG00000015028 transcript:ENSAPLT00000015707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKED
ILDFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKS
NVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLC
SNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRY
LETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIE
PMLKDLEEHIVSAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTA
RDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSE
EIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPAD
YVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLP
TELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQ
RPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSV
NQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKK
ITNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA
Download sequence
Identical sequences R0JHP7
ENSAPLP00000014920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]