SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014935 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014935
Domain Number 1 Region: 222-539
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.77e-91
Family p120GAP domain-like 0.0000305
Further Details:      
 
Domain Number 2 Region: 96-218
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000512
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 
Domain Number 3 Region: 44-95
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000841
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014935   Gene: ENSAPLG00000015053   Transcript: ENSAPLT00000015722
Sequence length 1001
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744822.1:240706:276734:-1 gene:ENSAPLG00000015053 transcript:ENSAPLT00000015722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSG
SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVENMLKLWIIEAKDLPAKKKYLCELCLD
DVLYARTTCKLKTDNVFWGEHFEFNNLPSLKNITVHLYKETDKKKKKDKTNFIGQVNIPV
SSVTGRQFVEKWYPVVSPNPGKGKSPGPMIRIKSRYQSMSILPMEMYKEFAEYITNNYMV
LCSVLEPSLSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLA
TKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLPEHQSNLKMCCELA
FCKIINSYCVFPRELKEVFASWRQECSNRGRPDISERLISASLFLRFLCPAIMSPSLFSL
LQEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNP
ETISNTAGFEGYIDLGRELSTLHSLLWEVISQLEQGTATKLGPLPRILRDVNSALSNPAC
VQVSVTADHTASTPNAGNSISAGLQKMVIENDLSGLIDFTQLPSPTPENKDLFFVTRSAG
AQPSPARSSSYSEANEPDVQMSNGSKSLSMVDLQDNRLLDSGANAPGAADSLNDSQSSLG
QLQGVWSARTQQSSVPAMATVRXPRGLGDSGSECHSSLSSHSNSEELTANKHGFAGPTXL
TEKGGQPTMPRQNSAGPQRRIDQPPPPPPPAPPSLLNTVQYQRPSSGSMMSSSPDWPGXR
QQSSSSKGDSPEMKQRTMHKQAPSPVNPNALDRTAAWLLNMNMQFLEDESIDPDSKHRDK
LRNKDELSQAEKDLVVLQDKLRISNKKLEEYETRFKCQEETTQKLMLEYQARLEESEERL
RRQQEDKEIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARL
MSALTQLKERYSMQTRNGISPTNPTKLQITENGEFRNSSNC
Download sequence
Identical sequences U3J608
ENSAPLP00000014935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]