SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014950 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014950
Domain Number 1 Region: 333-448
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-49
Family ets domain 0.000000958
Further Details:      
 
Domain Number 2 Region: 43-146
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.07e-33
Family Pointed domain 0.000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014950   Gene: ENSAPLG00000015060   Transcript: ENSAPLT00000015737
Sequence length 455
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742411.1:1102932:1113403:-1 gene:ENSAPLG00000015060 transcript:ENSAPLT00000015737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQPAFDTFDSTNSLFSGYFLSLNEDQTLQEVPTGFDSTSYESNNCELPLLTPCSKAVMSQ
ALKDTFSGFTKEQCRLGIPNNPWLWTEQQVCQWLSWATNEFSLANVNFHQFLMSGQDLCN
LGKERFLELAPDYVGDILWEHLEQMIKDSQEKTQDQYVENPHLTSVPHWVNNNSLTVNVD
QTPYGMQMPGYPKALSYPKPSLLSDVCQTSTGPNLLNPEQEFSLFPKTQVDAVGVNYCAV
NQDFTRSNLNLLIDNSGKLREHESSDSGAESYESSDSMLQSWNSQSSLVDLQRVPSYESF
EDDCSQSLCLNKPTMSFKDYIQDRSDPVEQGKPVIPAAILAGFTGSGPIQLWQFLLELLT
DKSCQSFISWTGDGWEFKLADPDEVARRWGRRKNKPKMNYEKLSRGLRYYYDKNIIHKTS
GKRYVYRFVCDLQNLLGYTAEELHAMLGVQPDTED
Download sequence
Identical sequences U3J623
ENSAPLP00000014950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]