SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014976 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014976
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-38
Family GABARAP-like 0.0000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014976   Gene: ENSAPLG00000015119   Transcript: ENSAPLT00000015763
Sequence length 123
Comment pep:novel scaffold:BGI_duck_1.0:KB743520.1:2270447:2271987:-1 gene:ENSAPLG00000015119 transcript:ENSAPLT00000015763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATRLEEVAGIRAKFPTKIPVIVERYQKEKYLPLLDKTKFLVPEELTMTQFITIIRSRMAL
TATQAFYLLVNNKSLASMSLTMAEVYRDYKDEDGFVYMTYASQEMFGCFLLTQGKTLKCL
QKT
Download sequence
Identical sequences R0KYH4
ENSAPLP00000014976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]