SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015001 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015001
Domain Number 1 Region: 838-965,1139-1282
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.67e-28
Family p120GAP domain-like 0.041
Further Details:      
 
Domain Number 2 Region: 23-239
Classification Level Classification E-value
Superfamily Sema domain 3.79e-22
Family Sema domain 0.011
Further Details:      
 
Domain Number 3 Region: 241-284
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000244
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 447-535
Classification Level Classification E-value
Superfamily E set domains 0.0000356
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.041
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000015001
Domain Number - Region: 535-596
Classification Level Classification E-value
Superfamily E set domains 0.00482
Family Other IPT/TIG domains 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015001   Gene: ENSAPLG00000015114   Transcript: ENSAPLT00000015790
Sequence length 1355
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742595.1:1265065:1330952:1 gene:ENSAPLG00000015114 transcript:ENSAPLT00000015790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAITVRPTDSLLPSEELGIIKYHVEPLHFVDALWWGGHLFFPYYRWKAKSGTDPEPPSMA
VLHQLQPSERGFSLRGQVYLDCGCRSLIVSSSLVRQGAKGWWVGVFSLTWNATAVCIFGM
EEMREQACASTHFAVNENHCCKAGNHAEERSIKKSPTLIHSGLAAVYGTVVLNQIVLFLG
TDDGQLLKAILNEDMESNCPEVLYEIKEETSIFPKLRLDPVDNNYIYLSSANKVRRIPVA
NCSRYVSEQECLSAKDPYCGWCSLNRRCTLKENCTRSNSTKGWYNISHAPDKDLKILLSF
PERNKVTVSTSISKPLTSCTIEIVKPIEIFCEIALENTSCVCTLTNRVTMDHDCLVLEAS
LSSSSWNISQTFQLEKCGTWVNCPRCINDGDCASCKWTRVSPATACQDSCSTTTASQGIA
TTQKSERGGRRRVTAGKRTGEGTQHIKIHSIEPLWISTLGKSEITVKGENFTRASDIKLI
LTGISGCKPDIIKVRNVLNDTQMTFALPPTRKEAKSVCIQADGRRCSPAITLHYVSPPSC
FGITPNTSWISGGRKITASGRNFNVVDSVIISDDQRSNLTVSKCSGNESEYHYLTPSLSH
ATEGKVVDMILKVETTFIPCVKLHYHPDPVFINYQLHTELDPDLELKIYKENDNLNISKT
EVEVYLSYMNGTQTKKVWFNVQNITKKPDRSTILCKFKREGTDKIDFSTVKVFVKLGNFE
LEVKPTSSYIYLYVLILLPIVVGVIIVAFIVTRYKSKELTRKQSQQLELLEYEIRKEIRE
GFAELQMDELDVVDSFGTVPFLDYKHFAIRTFFPESGGFASIFSEDMPQSRDQTRKDESF
NMLHALICNKNFLVTLIHTLEKQKNFSVTDRCLFASFLTIALQTKLVYLTQILEVLTKDL
MEQSSNVQPKLLLRRTESVVEKLLTNWMSVCLSGFLRETIGEPFYLLVTTLNQRINKGPV
DAITCKALYTLNEDWLLWQVSEFKTVTLNVIFEKIPENESGDACQTIQVNVLDCDTIGQT
KEKSLQAFLNKNGFLYGLQMDEIGLELVSEEQQRELLDIDGTSEVLEDGIRKLNTIGHYE
ISNGATIKVFKKKTNTRPGVDYSDEHCHLILPDSEANKDVKGAGHKGKQKFKVKEMYLTK
LLSTKVAIHSVVENLFRSIWSLPNNKAPVAIKYFFDFLDAQAESKKITDPDVVHIWKTNS
LPLRFWVNILKNPQFVFDIKKTSHIDGCLSVIAQAFMDAFSLAEQTMGKEAPTNKLLYAK
DIPLYKKEVKAYYKAIRDLPQLTTSEVDEFLTQESKKHENEFNEEVALIEIYKYIVKYYD
EIVSKLERERGFEEVQKQLQQVKALFDEKKKCKWI
Download sequence
Identical sequences U3J674
ENSAPLP00000015001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]