SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015052 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015052
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 773-835
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000454
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 160-249
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015052   Gene: ENSAPLG00000015162   Transcript: ENSAPLT00000015842
Sequence length 871
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743944.1:3425960:3490209:1 gene:ENSAPLG00000015162 transcript:ENSAPLT00000015842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHIKVSGKKENVKEAKEKIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETG
CHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPIPDP
NSPTIQHISQTYNISVSFKQRSRMYGATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASAI
PVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCL
ARQYLMGCLPLVLMFDMKEEIEVEPQFITQLMEQLDVFISIKPKPKQPSKSVIVKSVERN
TLNMYEARKCLLGLESSGVTIPSNPSTVSCPVGLSCPGLDILSSAGLGLTGLGLLGPTAL
SVNTSTTPNSLLNALNSSVSPLQSPSSGTPSPTLWATSLANTNATGFSAIPHLMIPSTAQ
ATLTSILLSGVPSYGQNTPSPPPGLTPVEVHVNGMQPESKKGSPSLNGHVKTSNIKYAAL
SATSLGENVLSTNHSDSARQTSTHGASEQVAAKSNSAEGCNDAFVEVGMPRSPSHSANTS
DLKQMMSSSKQACTKRQTVELLQGTKNSHLHTTERLLSDAELSASESPMADKKAPGSERA
AERAAAAQQNSERARLAQPSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLG
FSKSMPAETIKELRRANHVSYKPSMTTTYEGSSMSLSRSNSREHLGNGSESDNWRDHNGL
GPTAHEFVSSIGSPKRKQNKSAEHYLSSSNYMDCISSLTGSNGCNLNSLFKGSDLPELFS
KLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRRKLFDP
ANIRASFLEGGASGRLPRQYHSDIASVSGRW
Download sequence
Identical sequences U3J6C5
ENSAPLP00000015052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]