SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015081 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015081
Domain Number 1 Region: 41-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-19
Family Linker histone H1/H5 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015081   Gene: ENSAPLG00000015232   Transcript: ENSAPLT00000015871
Sequence length 223
Comment pep:novel scaffold:BGI_duck_1.0:KB742585.1:83703:84807:-1 gene:ENSAPLG00000015232 transcript:ENSAPLT00000015871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSNLHPDRRKVMPAFPHAAEAPASARRGGCPRAVPARGWAGPSVTELITKAVSASKERKG
LSLAALKKALAAGGYDVEKSNSRIKLGLKSLVSKGTLVQTKGTGASGSFRLSKKPGEVKE
KAPKKRAAAAKPKKPAAKKPASAAKKPKKAAVKKSPKKVKKPAAATTTKKAAKSPKKATK
AAKPKKAVAAKSPAKAKAVKPKAAKPKTAKPKAAKAKKAAPKK
Download sequence
Identical sequences U3J6F4
ENSAPLP00000015081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]