SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015106 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015106
Domain Number 1 Region: 216-294
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000816
Family PCI domain (PINT motif) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000015106
Domain Number - Region: 77-123
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.0536
Family Domain of poly(ADP-ribose) polymerase 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015106   Gene: ENSAPLG00000015241   Transcript: ENSAPLT00000015898
Sequence length 331
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745312.1:99217:107121:-1 gene:ENSAPLG00000015241 transcript:ENSAPLT00000015898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPTVALTFLEKTREKVK
SSDEAVILCKTAIGALKLNIGDLQVTKETIEEVEEMLNNLPGVTSVHSRFYDLSSKYYQT
IGNHASYYKDALRFLGCIDVKDLPVSEQQERAFTLGLAGLLGEGVYNFGELLMHPVLESL
RNTDRQWLIDTLYAFNSGNVETFQALKSAWGQQPDLAANEALLLQKIQLLCLMEMTFTRP
ANHRQLTFEEIAKSAKVTVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQ
IKGMKDRLEFWCTDVRSMEMLVEHQAHDILT
Download sequence
Identical sequences U3J6H9
ENSAPLP00000015106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]