SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015107 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015107
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-21
Family Vacuolar sorting protein domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015107   Gene: ENSAPLG00000015256   Transcript: ENSAPLT00000015897
Sequence length 68
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB748353.1:2645:3606:1 gene:ENSAPLG00000015256 transcript:ENSAPLT00000015897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLIYQWVSKNGLTNSVFTLYELVSGDDTAEEEFHGLDEAMLLRALQALQQEHKAEIITLD
DGRGVKFF
Download sequence
Identical sequences U3J6I0
ENSAPLP00000015107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]