SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015124 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015124
Domain Number 1 Region: 443-711
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-76
Family Protein kinases, catalytic subunit 0.000000000129
Further Details:      
 
Domain Number 2 Region: 109-181
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 181-234
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015124   Gene: ENSAPLG00000015187   Transcript: ENSAPLT00000015915
Sequence length 760
Comment pep:novel scaffold:BGI_duck_1.0:KB743260.1:1229840:1284497:1 gene:ENSAPLG00000015187 transcript:ENSAPLT00000015915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNG
TDFSVSSSASTDTVASSSSSSLSVATSSLSVYQNPTDMSRNNPKSPQKPIVRVFLPNKQR
TVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLFVSKFFEHHPIPQEEASLGETTPASGSYPSVPPSDSVGPSILPSPSPSKSIPIPQPF
RPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGVRGEGAPLNQLMRCLRKYQ
SRTPSPLLHSVPSEIVFDFEPGPVFRGSTAGLSATPPASLPGSLTNVKALQKSPGPQRER
KSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLN
VTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIET
KFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSG
SHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQII
FMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR
SASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGGFPVH
Download sequence
Identical sequences R0LHQ1
ENSAPLP00000015124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]