SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015138 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015138
Domain Number 1 Region: 407-609
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-46
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 614-738
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-25
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 153-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000217
Family Ras-binding domain, RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015138   Gene: ENSAPLG00000015286   Transcript: ENSAPLT00000015930
Sequence length 738
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745306.1:999:6967:-1 gene:ENSAPLG00000015286 transcript:ENSAPLT00000015930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LERPHSLPGSPAGPWRALSPTXEHSRAQPGVGVLLPGPPSPAQGCAPQVCHHAECQQLNH
SSPLSLCEVCDGRLHGTMHFSGGSRHSSAPRLCAGSILARNVSTRGCPDPARPQPAGTPR
SPCPRCAHRDRRSSALKLPKKKARRRHTDDPSKECFTLKFDLNVDIEAEIVPAMKKKSLG
EVLLPVFERKAIEQSKVDIYLDQSNTPLSLHFEAYRFGGHYLRVKATAKPGDELRAPRGG
PELPRRPQGLPWLRSQGHAAPAPGGCGPRVPSRGIVAASPLLERKNMTEFLGDASIPGPE
LSPHGSGSLPTNGTDTWKNRAARGGPCLVPSAPGASAPCFLGRRWEKMEQLESKLHTYSS
FGLPKLPPQLRFDQDSWEEDGDDSSLALEDSWQQIIEGTEVGPGGATEATYIRKLKVITD
LFLCCLLNLQESGLLCEVDAERLFGNIREIIQLHRSLWSSVMAPVLEKKARRTKALLDPV
DFLKGFKAFGSLFKPYIQYCMEEEGCMEYMRTLLRDSEFFRAYVTWAEKHKQCSRLKLSD
MLVKPHQRLTKYPLLLKSVLKKTDDPRTRDAVLTMIGSVEHFINHVNSRMRQRQEQQRLA
AILGRIDAYEVVEGSTDEVDKLLKEFLRLDLTAPMPGTSPDDTRQLLLEGSLKMREGKDS
KMDVYCFLFTDLFLITKPVKKAERTKVVRQPLLVDKIVCRELKDPGSFLLIYLNEFGSAV
AAYTFQASGQSLCRSWVE
Download sequence
Identical sequences U3J6L1
ENSAPLP00000015138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]