SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015150 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015150
Domain Number 1 Region: 54-424
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.6e-123
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015150   Gene: ENSAPLG00000015266   Transcript: ENSAPLT00000015942
Sequence length 543
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744049.1:138972:149197:1 gene:ENSAPLG00000015266 transcript:ENSAPLT00000015942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGAGVRPAERTPTGSSTFKKSLTPEMPGSSGQPGSQTIKKGHRGVDSTGETTYKKTTSSA
LKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAP
VAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFL
QKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHLKYDLKGST
YKRRASQKEREKVFPTYKDLDFMQDIPDGLFLDSDMYNALCKTLQRDCLVLQSFKIMDYS
LLVAIHNIDLAQREHALADGTSQADTRRPAAQKALYSTAMESIQGEARRGGTIETDDQMG
GIPARNAKGERLLLYIGIIDVLQSYRFVKKLEHSWKALVHDGDTVSVHRPSFYAERFQRF
MCNTAFKKIPLKPSPSKKSRSGTAVPRRSCQGGVPFQSHMSCETKAQVTTEVDVEQGSHL
GRPDLLPRTLPVDEANSDSVATTLSTSSLGSGGLNSPANRSVGVQVHKADSSAKDLTRAA
TGI
Download sequence
Identical sequences U3J6M3
ENSAPLP00000015150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]