SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015151 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015151
Domain Number 1 Region: 594-896
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-83
Family Protein kinases, catalytic subunit 0.0000000000919
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.57e-77
Family Ephrin receptor ligand binding domain 0.0000000135
Further Details:      
 
Domain Number 3 Region: 304-509
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-42
Family Fibronectin type III 0.000026
Further Details:      
 
Domain Number 4 Region: 891-965
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.73e-21
Family SAM (sterile alpha motif) domain 0.000047
Further Details:      
 
Domain Number 5 Region: 233-304,342-361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000646
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015151   Gene: ENSAPLG00000015180   Transcript: ENSAPLT00000015943
Sequence length 967
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742757.1:665078:740601:-1 gene:ENSAPLG00000015180 transcript:ENSAPLT00000015943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLMDSTTATAELGWTVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKYIRR
RGAHRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYYESDFDSATKTFPNWMENPWMKVDT
IAADESFSQVDLGGRVMKINTEVRSFGPVSKNGFYLAFQDYGGCMSLIAVRVFYRKCPRV
IQNGAVFQETLSGAESTSLVAARGTCITNAEEVDVPIKLYCNGDGEWLVPIGRCMCRAGY
ESVENGTVCRGCPSGTFKASQGDEGCIHCPINSRTTSEGATNCVCRNGYYRADADPVDMP
CTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGAGRGACTRCGDNVQ
FAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVS
IMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKDLSELNSTTVKSPTNTVTVQNLKA
GTIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSVQEKLPLIIGSSAAGLVFLIAVVI
IIIVCNRRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDIS
CVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDH
PNVIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAD
MNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQ
YRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPNALHQLM
LDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVD
EWLDAIKMSQYKESFASAGFTTFDIVSQMSVEDILRVGVTLAGHQKKILNSIQVMRAQMN
QIQSVEV
Download sequence
Identical sequences U3J6M4
ENSAPLP00000015151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]