SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015156 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015156
Domain Number 1 Region: 307-444
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-51
Family ets domain 0.00000307
Further Details:      
 
Domain Number 2 Region: 105-194
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.53e-28
Family Pointed domain 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015156   Gene: ENSAPLG00000015271   Transcript: ENSAPLT00000015948
Sequence length 478
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742411.1:1273138:1336941:1 gene:ENSAPLG00000015271 transcript:ENSAPLT00000015948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALSVVSEDQSLFECAYGSPHLGKTEMTASSSSEYGQTSKMSPRVPQQDWLSQPPARVTI
KMECNPNQVNGSRNSPDDCSVAKGGKMVSGSDNVGMNYGSYMEEKHIPPPNMTTNERRVI
VPAVTLDPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQNIDGKELCKMTKDDFQRLTPSY
NADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGATFIFPNTSVYPEATQR
ITTRPDLPYEQARRSAWTSHTHPTPQSKATQPSSSTVPKTEDQRPQNFLDPYQILGPTSS
RLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMN
YDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSMYKYPSDLPYMSSY
HAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPAAHMPSHLGTYY
Download sequence
Identical sequences U3J6M9
ENSAPLP00000015156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]