SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015182 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015182
Domain Number 1 Region: 170-414,470-554
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.65e-95
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000154
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000015182
Domain Number - Region: 689-751
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000289
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number - Region: 1035-1101
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0224
Family Ubiquitin-related 0.02
Further Details:      
 
Domain Number - Region: 1228-1258
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0777
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015182   Gene: ENSAPLG00000015288   Transcript: ENSAPLT00000015975
Sequence length 1362
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742934.1:336732:374244:1 gene:ENSAPLG00000015288 transcript:ENSAPLT00000015975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMFWSCRQSIFAEMKKKFSQVESAAEEPRVLCIIQDTTNSKTVNERVTLNLPASTLLKKL
FEDVASKVGYVNGTFDLVWGNGDNVTDTTPIDQNSDKTILDAGFEPGKKNFLHLTDKDGE
QPHIRSEESGTTDDSMQDRFIGPLPREGSVGCTSDYVSQSYSYSSVLSKSETGYVGLVNQ
AMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIET
TDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLE
CGYEGWRIDTYLDIPLVIRPYGSNQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDA
RKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSIFIDVEDEKSPQTES
CTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLESNSAAERISKVGSEKNSLLYELFSVM
VHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSKITQEDIKKTYGGSSGSRGYYSSAFASS
TNAYMLIYRLKDPARNAKFLEAHEYPDHIKQLVQKERELEEQEKKQREIERNTCKIKLFC
MHPTKQIMMENKLEVHKDRTLKEAVEIAYKLMDLEEAVPLDCCRLVKYDEFHDYLERSYE
GEEDTPMGLLLGGVKSTYMFDLLLETRRPDQIFQCYKPGEVMVKVHVVDLKAESVAPPIS
VRAYLNQTVSEFKQLISKATHLPAETMRVVLERCYNDLRLLNVSSKTLKAEGFFRSNKVF
IESSESLDHHVAYTDSHLWKLLDRHANTIKLYVSLPEQSPGSQFRRSIYQKPSGDSGNLD
EASERVKGPVGNMKSVEAILEESTEKLKSLSLQQQQEGDNGDSSKSTEASDFENIESPSN
EIDSSASAENRELENQIQISDPENLQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCN
VDNAPIPLANGLDSHSITSSRRSKANQGKKETWDTAEEDSGTDSEYDESGKSRGEAQYMY
FKSEPYTADEGSGEGQKWLMVHVDKRITLSAFKQHLEPFVGVPSSHFKVFRVYASNQEFE
SVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEPEPCKFLLDAVFAKGMTVR
QSKEELLPQLREQCGLDLTTDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEIL
DGVEKMKSMSQLAVLSRRWRPSEMKLDSFQEVVLESSSVEELKEKLSEVSGIPLENIEFA
KGRGTFPCDISILEIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRN
ELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Download sequence
Identical sequences U3J6Q5
ENSAPLP00000015182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]