SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015303 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015303
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.34e-46
Family Interferon regulatory factor 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015303   Gene: ENSAPLG00000015442   Transcript: ENSAPLT00000016098
Sequence length 348
Comment pep:novel scaffold:BGI_duck_1.0:KB745806.1:79738:103960:1 gene:ENSAPLG00000015442 transcript:ENSAPLT00000016098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVERMRMRPWLEEQINSNTIPGLKWINKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKYQSGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK
KGKKTKSEKDDKFKQIKQEPVESSFGINGLNDVTSDYFLPSSIKNEVDSTVNIVVVGQPH
LDGSSEEQVIVANPPDVCQVVEVTTESDEQPLSMSQLYPLQISPVSSYAESETTDSVPSD
EENAEGRLHWQKKNIEGKQYLSNLGMRNTSHTLPSMATFVANKPDLQVTIKEESCPLPYN
SSWPPFPDIPLPQVVSTASTSSSRPDRETRASVIKKTSDITQSRVKSC
Download sequence
Identical sequences R0KKD4
XP_005030555.1.99704 XP_012964767.1.99704 ENSAPLP00000015303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]