SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015320 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015320
Domain Number 1 Region: 200-347
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-37
Family Third domain of FERM 0.00069
Further Details:      
 
Domain Number 2 Region: 97-202
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-36
Family Second domain of FERM 0.0000448
Further Details:      
 
Domain Number 3 Region: 21-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-17
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015320   Gene: ENSAPLG00000015395   Transcript: ENSAPLT00000016115
Sequence length 681
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743958.1:11155:94099:-1 gene:ENSAPLG00000015395 transcript:ENSAPLT00000016115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGLFCIITLYLPSLFVVDCKAKQQIRGLQKSTKGSVVLGYVFRHLNLVEIDYFGLRYCDR
SHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDIL
QGRLPCPVNTAAQLGAYVIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEDAIERIHKTL
MGQVPAEAEANYLGVAKSLEMYGVDLHPVYGENKSEYFLGLTPIGVVVYKNKKQVGKYFW
PRITKVHFKETQFELRVLGKDCNETSFFFEARDKITCKHLWKCCVEHHTFFRVPENESSS
LSRKFSKFGSIGYKHRYSGRMSLQMTRDPSVQLPRPDQCIERSRSKTYPKRTQQTAETQP
VGSSSMNQIATNGDNEGTTKIIAPSPVKSFKKMKNENSPETQRSKTSAPWEENGLQSGLY
NSPSDRNKSPKFPYSRRRNPSGGSENESGQPVRRRKTQNCGEDSELKQRRRSRSRCNTSS
GSESENSNREHRKKRNRLRQENDMVDSAPQWEAVLRRQKEKNQADPNYRRSRHRSRSRSP
DVQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQYYRRS
QCSDGERSVLSEVNAKNDMVPPLPVTRSSDAKGPSIQLTQQRRNGSKDSLIEEKSLLSTN
DGKPTTKTIKTVQVSRFKVET
Download sequence
Identical sequences U3J743
ENSAPLP00000015320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]