SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015349 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015349
Domain Number 1 Region: 50-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000013
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015349   Gene: ENSAPLG00000015501   Transcript: ENSAPLT00000016144
Sequence length 135
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743740.1:310736:311914:1 gene:ENSAPLG00000015501 transcript:ENSAPLT00000016144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKDGSFTGFIKVQLKLARPXXXXXXXXXXXXXXPGQRGPGVKRRTSFYLPRGTVKHLHIL
SHTRASEVISALLRKFTVVDDPRKFALFERSEKDDQVFLRKLSDEEQPLRLRLLAGPSEK
ALSFVLKENDSGEVN
Download sequence
Identical sequences U3J772
ENSAPLP00000015349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]