SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015365 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015365
Domain Number 1 Region: 314-412
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-19
Family UBX domain 0.026
Further Details:      
 
Domain Number 2 Region: 4-34
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000227
Family UBX domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000015365
Domain Number - Region: 40-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00132
Family UBX domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015365   Gene: ENSAPLG00000015504   Transcript: ENSAPLT00000016161
Sequence length 448
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742551.1:462962:508536:1 gene:ENSAPLG00000015504 transcript:ENSAPLT00000016161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFRFQRSVLDLSLQWRFARLPNNAKLEMVPVSCNRAGIGNTVRIALQLDDGSRLQDTFL
CQQTLWELLNHFAKTREFMEQHGEFCPVCIYMRDEISGKDELEKTTLKSLGLTGGSAIIR
VVMKKCSLSGQEEAVDAMTQCNEPVVRPGSIRGAEDVPLPQMHMFPKDLDHRDVALSLNC
CTDNQGLIREPNASVEELCPPSEPKSTPFVPFFGDGQRLGDTSVATPPLGLDKPSSKLPA
TFSSPGGPSEPKKSKNSQELQNEQEQFVEREPLLCHLDLLEPLPAGLDDLPDDFFEVTVD
DVRKRLAQLQSERKRLEEAPLLTSSLREAQMKEKIERYPKVVLRVHFPDRHVLQGFFRPS
ETVGILRDFVRSHLADADLPFYLFIAPPRVILNNESLTLFEAKLFPAAVVHFGSEERRDC
YLKSDLLSSAVSPSAADLLVSRCLSKSL
Download sequence
Identical sequences U3J788
ENSAPLP00000015365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]