SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015464 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015464
Domain Number 1 Region: 306-648
Classification Level Classification E-value
Superfamily DNase I-like 3.53e-78
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000142
Further Details:      
 
Domain Number 2 Region: 806-975
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-32
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015464   Gene: ENSAPLG00000015547   Transcript: ENSAPLT00000016262
Sequence length 979
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744367.1:156409:173231:1 gene:ENSAPLG00000015547 transcript:ENSAPLT00000016262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSVAIQETLANGATCRIAVQGTLAGGESVESRLLGLVESCGEHAIYVYTHRRMAITAE
DVWLEKVIPIREGFAVEEVIPDSDLHVIGSDVTVQISSEDDRLMVRLPFGSHTRTFLQEL
SRCSPGTSSAVCLGLEAQGAWLVACGHHLLLWPGRQRLGGTPGFRGISRDGSRAAPGQLQ
GPGATPEQLWDGSRALRQLQEQLQSDSTDWGRPGRMMLDCVFLELEELGRDLNPLNGSKG
REVVGSEGIKQNGKKLAVNQNWSHDSTDKGAPRQSKVKSDVKAEMVRSSGVMVSNVASIL
SEPQFGLRDTIVKSQLVQKEDSYTYIQNFRFFVGTYNVNGQSPKESLQPWLRCDTEPPDI
YCVGFQELDLSKEAFFFNDTPKEEEWFKAVTDSLHPDAKYAKVKLVRLVGIMLLLYVKAD
LALNISEVEVETVGTGIMGRMGNKGGVAIRFKFHNTSVCIVNSHLAAHTEEYERRNQDFK
DICSRMQFCQSDPNLPPLTISKHDVILWLGDLNYRLEELDVTKVKQLVEEKAFSELCRYD
QLKRQMNAKAVFEGFTEGEISFQPTYKYDAGCDDWDTSEKCRVPAWCDRILWKGQNIAQL
SYRSHMALKISDHKPVSSVFDIGVKVVNEELYRKVFEEIVRSLDKMENANIPSVTLSQRE
FHFEDVKYMQLQIEKFTIRNGQVPCQFEFISKPDEETYCKEWLIANPSKGFLLPDSEITI
ELELFVNKSTATRLNSGEEKLEDILVLHLDRGKDYFLSVTGNYLPSCFGSPIHTLCYMRE
PIQDMSAESIQNLTLMPLETSDAATQAERPLEIPKELWMMVDHLYRNASQQEDLFQQPGL
RSEFEQIRDCLDKGMHDTLLGSNHSVAEALLLFLESLPEPVICYSFYNSCLECANNYLLS
SQIISKLPECHKNVFEYLMAFLRELLKNSGKNHLDVNILDAASIFGGLLLRPPPGHPTPD
IAEKRKAQQFIHQFLLRED
Download sequence
Identical sequences U3J7I7
ENSAPLP00000015464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]