SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015659 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015659
Domain Number 1 Region: 275-461
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 23-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.24e-38
Family BAR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015659   Gene: ENSAPLG00000015783   Transcript: ENSAPLT00000016460
Sequence length 664
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742823.1:404625:410155:-1 gene:ENSAPLG00000015783 transcript:ENSAPLT00000016460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRQFNRMRQQLSHPNATSRAQEATELLTEDLLQAEDRAGQAFKRAAHSVSKRLQACLQ
GHCGSEMDKRVKKLPLMALSMTMAESFKELDTDSSLGKALEMGCCIQSSLAKILAEFEIT
VERDVLQPLNKLRRSWLPIILKRKKTLQKLISDWNAIKSRLNQAAKGSGNSAGAGTVPGA
SSANKLEILKEEEEEVKRKVEQCKDEYMADLYHFSTKEDSYASYFIRLLEIQAQYHQSLG
SLDSALAELKESHRQTGTRWLSRQPGEGCEHSWRGXEIALPIEACVMMLLASGMREEGLF
RLAAGASVLRKLKSSLASGSNALEEFYSDPHAVAGALKSYLRELPQPLMTFELYDEWVKV
ASLKDVDSRVQSLRDTCSRLPQDSYNNLRYLIKFLAKLAEHQEVNKMTPSNIAIVLGPNL
LWPQPSTGDPVQLDLASVSSIQVVGIVEALIQNADTLFPGDVDFNVSGMFTPPADVRLSK
DTPTEEPSPKSPVASSPALPDEEGQSLIVPFSPSTRDPEVSTQPPSTEVTRPSPEATVPP
AHDSIRKAKRPAPARPTVPPPVAQPRSTVPEHATSPKARPRRIGAPSIPPPLPPQPAPRH
SRESLTSPGPPSAKATTTTPDWDEGPAGGRSPTGGIADGGLAGRGTGPAVAPPPFCQHFA
SKLG
Download sequence
Identical sequences U3J831
ENSAPLP00000015659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]