SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015661 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015661
Domain Number 1 Region: 141-242
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.64e-36
Family MBT repeat 0.00000589
Further Details:      
 
Domain Number 2 Region: 52-167
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.17e-34
Family MBT repeat 0.0000171
Further Details:      
 
Domain Number 3 Region: 617-691
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.73e-19
Family SAM (sterile alpha motif) domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015661   Gene: ENSAPLG00000015777   Transcript: ENSAPLT00000016462
Sequence length 694
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743739.1:126849:177019:1 gene:ENSAPLG00000015777 transcript:ENSAPLT00000016462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPGPQKAIDWKDGKKHKYSRPSESPSQYQGHFTWEKYLKETCAIPAPAHCFKQSYTPP
ANEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIG
NCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPVRIFHKEPPSPSQNFFKTGMKLE
AVDRKNPHFICPATIGEVRGSEVLITFDGWRGAFDYWCRYDSRDIFPVGWCSLTGDNLQP
PGTKVVIPKSPLPASEVNSEKPSMHSSTKTVLGHQQGQRRRKTGKKRGRTTKALIHHPMP
TPSKSVEPLKFPRKRGPKPGSKRKPRTLLNPAPTSPTTSTPEPDTSTVPQDAATIPSSAM
QAPTVCIYLNKNGSTGPHLDKKKVQQLPDHFGPARASVVLQQAVQACIDCAYHQKTVFSF
LKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEKLCHNLRSDNLFGNQPFTQNSHM
QRSHEYDHDRYLPDRSSSLDGTLQGPGRGTKRYSQDSPPYSAPLSPKLPKNDRHPLEGET
FVLGDGLPGPLEPRLDPMDSALNSVNSSSHSRSSRDYRLQGYRHLHQPSSLTQGSTSALR
RLSSGGSDRYLGSRDVSRLNSRDPSSWTVEEVMQFIREADPQLGPHADLFRKHEIDGKAL
LLLRSDMMMKYMGLKLGPALKLTYHIDKLKQGKF
Download sequence
Identical sequences U3J833
XP_005025311.1.99704 XP_013053094.1.65836 ENSAPLP00000015661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]