SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015662 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015662
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000209
Family Rps19E-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015662   Gene: ENSAPLG00000015797   Transcript: ENSAPLT00000016463
Sequence length 70
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744878.1:1059:1371:1 gene:ENSAPLG00000015797 transcript:ENSAPLT00000016463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNSLFSPSASTARHLYLRGGAGVGSMTKIYGGRQRNGXXXXXXXXXXXXXXXXVLQALEG
LKMVEKDQDG
Download sequence
Identical sequences U3J834
ENSAPLP00000015662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]