SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015746 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015746
Domain Number 1 Region: 538-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-77
Family Protein kinases, catalytic subunit 0.0000295
Further Details:      
 
Domain Number 2 Region: 1163-1207
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000137
Family SAM (sterile alpha motif) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015746   Gene: ENSAPLG00000015796   Transcript: ENSAPLT00000016547
Sequence length 1208
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742937.1:438:68894:-1 gene:ENSAPLG00000015796 transcript:ENSAPLT00000016547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSESLQSLKEIICQKNNMCT
GNYTFVPYMITPHNKVYCCDSSFMKGLTELMQPSFESLLGPICLPLVDRFIQLLKVAQAS
SSQYFRESILNDIRKARTLYTGKELAAELARIRQRVDNIEVLSADIVINLLLSYRDIQDY
DSIVKLVKTLEKLPTFDLASHHHVRFHYAFALNRRNLPGDRQKALEIMIPLVEQEDQVAS
DMYCLVGRIYKDMFLESGFIDLECRDKGTFWFKKAFESEPTLQSGINYAVLLLAAGHCFD
TSFELRKVGVKISSLLGKKGSLEKLQSYWEVGSFLGASMLANDHIRVIQASEKLFKLKAP
AWYLKSIVETILIYQHFKKLNPEQHTAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPT
KIYQPSYLSINSEAEEKTVSIWHVLPDDKKGIHEWNFSAASIRGVSISKFEERCCFLYVL
HNSDDFQIYFCTELHCRRFFDMVNSITEEIGKTTEEGECDGDSLEYDYEYDENGERVVLG
KGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSLSED
GFIKIFMEQVPGGSLSALLRSKWGPLKNNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGD
NVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSL
GCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPESMSAEAKAFILRCFEPDPDKRA
FAHELLVDEFLKVSSKKRKSPSKLSVLSANTNEYLRSISLPVPVLVEDTSSSSEYGSVSP
DTELKIDPFSFKTRAKSCGEKDGKGIRSLFLSIPDENFEDHSAPPSPEEKDSGFFMLKKD
SERRATLHRILTEDQEKVVRNLMEALAQGAEEPKLKWEHIMTLVSSLREFVRSTDRKIIA
TTLSKLKLELDFDSHGISQVQLVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAI
TILVPELRPHFSLASESDAADQDDIEVEEDQDDQPQNQTIQQPCIVMEDAIATSGVSTLS
STVSHDSQAAHRTLSVQLGRLKLETNRLLEELVQKEREFQVLLHQAIEEKDQEIKNLRLR
SQPIDIPGLSVCHRHSTGTGTEDPDLINWLSVQGADEATINKFLAEDYTLMDVLCYVTRD
DLKCLRLR
Download sequence
Identical sequences U3J8B8
ENSAPLP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]