SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015785 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015785
Domain Number 1 Region: 373-539,836-1054,1108-1145
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-109
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 520-609
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-18
Family PDZ domain 0.008
Further Details:      
 
Domain Number 3 Region: 251-375
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-17
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000089
Family cAMP-binding domain 0.0056
Further Details:      
 
Domain Number 5 Region: 746-825
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000672
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015785   Gene: ENSAPLG00000015846   Transcript: ENSAPLT00000016587
Sequence length 1609
Comment pep:novel scaffold:BGI_duck_1.0:KB742531.1:952208:1052069:-1 gene:ENSAPLG00000015846 transcript:ENSAPLT00000016587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WPGPEGAGASSAGKEKNPPVRDSKDLNTIYSFLHGLDILSHFREHQLRIMSSSARYERYK
GNQVLFCSETIARCWYILLSGSVLMKDSMFLPPCSFGKQSGGKRGCECIILEPSEMIVVE
NSKDNEENILQREVPLRQSRRRFRKINQRGERQTITDNVDASSYISLPADLTKMHLTDNP
HPQVTHVPSSQSGCSIASDSGSSSLSDIYQATESEMGDVDLTGLPEAPVDSIDRTSDPLL
GRDVVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEVVEQAGAI
ILEDGQELDSWYVILNGTVEISYPDGKSESLCMGNSFGITPSLDKQYMNGVVRTKVDDCQ
FVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVKEHRELDRSGTRKGHIVIKATPERLIMH
LIEEHSIVDPTYIEDFLLTYRTFLTSPLEVGNKLLEWFTVDSLRDKVTRVVLLWVNNHFN
DFEGDPAMTRFLEEFEKNLENTKMKGHLRLLNIACAAKAKWRQITLQKPSRDSPLFFSLL
GGSDKGFGIFVETVETGSKAAEAGLKRGDQIMEVNGQNFENITFVKALEILRNNTHLSIT
VKTNIFVFKELLCRIGQEKNGIPHIPKIAEKKNNRYSIPDMPGDVEQMFPREKGNKKMKA
NTVSGGRNRIRKILDKTRFSILPPKLFSDGSVSQSQDDSIVGTRQCRHSLAIMPIPGTLS
SSSPDLLQPTTSILDFSNPSDIPDQVIRVFKADQQSCYIIISKDTTAKEVVSHAVHEFNL
TGAPETYSLCEVSVSPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLCSDEDAQ
ELLRESQISLLQLSTIEVATQLSMRDFELFRNIEPTEYIDDLYKLDSKTGNAHLKQFEDV
INQETFWVAMEILAEPNQLKRMKIIKHFIKIALHCRECKNFNSMFAVISGLNLAPVARLR
GTWEKLPSKYEKHLRDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDITFLHEG
NDSKVDGLVNFEKLRMIAKEIRQVVRMTSANMDPAVMFRQRKKRWRSLGSLSQGSTNSNM
LDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSNLNVETDEEKIQILSLQCEPAY
STLTKNLSERRGAKSSEMSPVPMRSIGQTTKAHQHQQNRMSQVLQVPTVNLYPSRKKGLT
KDHVTFSTGSPQKSLSLSEEVSTKKQTEDTMSMASSLHSSPPASPQGSPRKGYALIPSTK
SDNFSDSSHSEISSRSSIVSNCSVDSMSAALQDERGLSQSLTVVDAAGADRKEHPQPLTD
YGQPCPGWSITRPALIRGMAFTSSMSNEEISHDHITVEAADSGRGSWTSCSSSSHDNFQN
IPNQKSWDLLNSYRHTQLDGPIAEVDPTNCYSEEAYLYSEAFSKNNRQSKASVEHDQSRQ
SWASSSSLSDTYETNYGTIKRRGLENSTSEQTEVLDSKPGTDTTYKTVTSSTEKGLIVYC
VTSPKKDDRYREPPPTPPGYMGISLADIKEGSPHHPHLKPPDYSVAVQRSKMLPSDLSRL
SSASLSSEPVACISSKMPQWHSRQPSNPKLADMTDADSEEDEDEQVSAV
Download sequence
Identical sequences U3J8F7
ENSAPLP00000015785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]