SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015808 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015808
Domain Number 1 Region: 51-378,408-520
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-120
Family Ras GEF 0.0000494
Further Details:      
 
Domain Number 2 Region: 639-733
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.23e-40
Family Ras-binding domain, RBD 0.00000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015808   Gene: ENSAPLG00000015888   Transcript: ENSAPLT00000016611
Sequence length 768
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744722.1:1110216:1186757:1 gene:ENSAPLG00000015888 transcript:ENSAPLT00000016611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGPWLAVISSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQ
YETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNL
ETLSCEEVGSQNSSGSKTVVRNAIASILRAWLDQCSEDFREPPNYLCLLKLLDYLKRSMP
GSDPERRAQNLLEQFQKQEVENDNGIHSTSPCNLYDEEEMEISSPEEFSFFREDLVAEQL
TYMDAKLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATIAQFNAVTKCVVSTILKSKEL
KTQQRAKIIEKWIHIAHECRILKNFSSLRAIVSALQSNSIYRLKKTWASVPKDRMLMFEE
LSDIFSDHDNYLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYL
GTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDQKFIQWF
RRQQLLTEEESYSLSCEIEAAVDTSTTSPKPRKSMVKRLSLLFLGSEVITNSTPTKEQPK
STPSGSSGESMDSVSVSSCESNHSESEEACITPIDTPDEPQKKLSESSSSCSSIHSMDTS
SSGVSSLTNVISSPPFLSSNPKIHKRSISVTSITSTVLPPVYNQQNEDTCIIRISVEDNN
GNMYKSIMLTSQDKTPAVIQRAMLKHNLESDTAEEYELVQVISEDKELVIPDSANVFYAM
NSQVNFDFILRKKASVDEQVKMRSRSSLTLPRTAKRGCWSNRNSKITL
Download sequence
Identical sequences U3J8I0
ENSAPLP00000015808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]