SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015899 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015899
Domain Number 1 Region: 125-305
Classification Level Classification E-value
Superfamily HAD-like 4.24e-30
Family NLI interacting factor-like phosphatase 0.081
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-19
Family Ubiquitin-related 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015899   Gene: ENSAPLG00000015997   Transcript: ENSAPLT00000016705
Sequence length 318
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744300.1:461784:471319:1 gene:ENSAPLG00000015997 transcript:ENSAPLT00000016705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSLIIKWGGQEYTITSLSEEDTVLDLKQSLKGLTGVLPERQKLLGLKMKGKPADDDVK
LGALKLKPNTKIMMMGTREESLEDVLGPPPDNDDVVNDFDIEEEVVEVENREENLLKISR
RVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIV
IWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFS
EYYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDF
LELNHKHWERYLSKKQGQ
Download sequence
Identical sequences A0A087VM49 A0A091H7N9 A0A091IB58 A0A091IY93 A0A091L487 A0A091NNN5 A0A091P178 A0A091PBC5 A0A091Q3A0 A0A091SRM3 A0A091TC21 A0A091V6A2 A0A091WQ68 A0A093F1J0 A0A093FDG2 A0A093GTV9 A0A093I4K8 A0A093J7P8 A0A093JHH4 A0A093QQF3 A0A094K6R8 A0A094MY74 A0A099Z2A0 A0A0A0A294 A0A1V4KU83 A0A218UPX2 A0A2I0LWK2 A0A2I0UEQ1 H0YQN3 U3J8S1
NP_001153493.1.42559 XP_005027955.1.99704 XP_005231887.1.75256 XP_005418831.1.5688 XP_005437056.1.10750 XP_005483778.1.73095 XP_005503398.1.63277 XP_005523682.1.90289 XP_005523683.1.90289 XP_008496877.1.100939 XP_008627186.1.15636 XP_008941106.1.37566 XP_009077928.1.14518 XP_009089751.1.15306 XP_009465131.1.38621 XP_009481240.1.14425 XP_009503200.1.22320 XP_009579514.1.87690 XP_009632994.1.23211 XP_009683969.1.43253 XP_009699302.1.71050 XP_009807313.1.37116 XP_009871149.1.31609 XP_009891508.1.48241 XP_009902909.1.92783 XP_009917992.1.2804 XP_009917993.1.2804 XP_009940891.1.35112 XP_009954301.1.99599 XP_009967646.1.75343 XP_010000297.1.85724 XP_010137859.1.100080 XP_010156483.1.22856 XP_010169877.1.30499 XP_010208195.1.23224 XP_010211987.1.20684 XP_010280460.1.48707 XP_010306438.1.13389 XP_010398002.2.2935 XP_010577305.1.12557 XP_010577306.1.12557 XP_010577307.1.12557 XP_011569731.1.59079 XP_011569732.1.59079 XP_011569733.1.59079 XP_013031527.1.65836 XP_013799084.1.3284 XP_014731505.1.99236 XP_014731506.1.99236 XP_014731507.1.99236 XP_014731509.1.99236 XP_015497679.1.82291 XP_021386396.1.53032 XP_021386398.1.53032 XP_021386399.1.53032 ENSTGUP00000000590 ENSTGUP00000000590 59729.ENSTGUP00000000590 ENSAPLP00000015899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]