SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015932 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015932
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-48
Family BAR domain 0.0073
Further Details:      
 
Domain Number 2 Region: 325-500
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00000152
Further Details:      
 
Domain Number 3 Region: 185-295
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000155
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015932   Gene: ENSAPLG00000016036   Transcript: ENSAPLT00000016740
Sequence length 501
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743759.1:148632:253856:1 gene:ENSAPLG00000016036 transcript:ENSAPLT00000016740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQKFSQSLQDFQFECIGDAETDDEINIAQSLKEFARLLIAVEEERRRLDGKKKFDKES
EKYYSILEKHLNLSAKKKESHLQDADTQIDREHQNFYEASLEYVFKIQEVQEKKKFEFVE
PLLAFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFESTRQEVERLMQRMKSANQ
DYRPPSQWTMEGYLYVQEKRESRPLGFTWVKHYCTYDKGTKTFTMSIAETKSGGKVNGLV
TSSPEIFKLKSCIRRKTDSIDKRFCFDIEVFERPGIITLQAFSESNRKLWLEAMDGKEPV
FGTGPAGCTPSPQSLVFLNEAGFNFVRKCIYAVETRGITILGLYRIGGVNSKVQKLMNTI
FSPKSPPDMDIDMELWDNKTITSGLKNYLSTRCLSEPLMTFKLHKDFIVAVKSDDQNYRV
EAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMRAQEETVAA
MMNIKFQNIVVEILIEHYEKV
Download sequence
Identical sequences U3J8V4
ENSAPLP00000015932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]