SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016086 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016086
Domain Number 1 Region: 156-330
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 32-149
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-30
Family Pleckstrin-homology domain (PH domain) 0.0000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016086   Gene: ENSAPLG00000016184   Transcript: ENSAPLT00000016899
Sequence length 638
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742633.1:161247:181363:1 gene:ENSAPLG00000016184 transcript:ENSAPLT00000016899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWDFNLKMDAAKIARSKSVMSGEAAGARPGSPNPLERPLKIGWLKKQRSIVKN
WQQRYFVLKGQQLYYYKDEDDVKPQGCLSLQGSTIKEVAGNSEDGGKFIFEIIPGISGDL
NRAGQDTCVLMATSQSEMEEWVKSIRRVLGSASGAVFGQRLAETMAYEQKFGQHQVPILQ
DNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRELPEPVVPWIQYEDFLLCGQALD
MDERKGHQELLEQLSLLPRDNYNLLSYICRFLHEIQLNSSVNKMSVDNLATVIGVNLIRP
KIEDPATIMRGTLQIQKVMTVMISDHADLFPPSKDVLPSPPTQQNDKKAPIPRSSVGWDA
AEDIIVPRTDSLIQRDNLNASSAPRLAVSSSAPSEDNGMQPSKDTLGIWKAQSRKRTQTL
PNRKSFLTAASPGEKGNNDKNDIFASDFWKGSPGSSMRSVTSEGHKRTLSHDLFKLLDLH
RASTYDNVPTSPAESGEGSSSSPIPESSSSDKEFQPCPSPSHQSKEPSSPASSPAEVSQL
DPESKEFLQNTILKLEKEMEAQKNEYVEQIKSLEKENYEVWAKVVRLNQDIEREKKKSEE
LELKLMNLERSREDLEKKNKVLEEEIKNIAKSRSKNDA
Download sequence
Identical sequences U3J9A8
ENSAPLP00000016086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]